PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G361500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 334aa    MW: 36058.5 Da    PI: 9.1579
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G361500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.71.6e-15263311554
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk + +el+k
  Sevir.5G361500.1.p 263 RRQKRMIKNRESAARSRARKQAYTNELENKVSLLEEENERLK-RQKELEK 311
                         79***************************************9.5566655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.4E-15257310No hitNo description
SMARTSM003387.1E-11259327IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.588261306IPR004827Basic-leucine zipper domain
CDDcd147071.59E-25263317No hitNo description
SuperFamilySSF579592.31E-11263308No hitNo description
PfamPF001708.7E-13263306IPR004827Basic-leucine zipper domain
PROSITE patternPS000360266281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGSQTMASKA GGGGGGGGGG GGAGAAQRGQ MQNLSRQGSL YNLTLDEVQS HLGEPLHSMN  60
LDELLKSVFP DGLEHDGGTT SQYEQTSGLL RQGSITMPPE LSKKTVDEVW KGIQDAPKRN  120
VTEGGRRRRE RQPTLGEMTL EDFLVKAGVV TQGYLKDLND VGNMEQVGSA GVSGLTAGAQ  180
WLDRYQQQIT AIEPHQHGQH GVPGAYMPSQ LALQPLNVGP GAILESYSDG HITSPMMGAL  240
SDSPTPGRKR GAPGDVADKL MERRQKRMIK NRESAARSRA RKQAYTNELE NKVSLLEEEN  300
ERLKRQKELE KILFSAPLPE PKYQLRRTGS ATF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124131GRRRRERQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970325.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES32e-84AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLK3XJV00.0K3XJV0_SETIT; Uncharacterized protein
STRINGSi002173m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-84ABA-responsive element binding protein 3